Textile Dictionary

Multi language textile dictionary based on data from Textile technical terminology by  Agnes Geijer (ed.), Marta Hoffmann (ed.) published on Johan Grundt Tanum Forlag (1979).

svennodaisfidefr
svennodaisfidefr
anbindepunktstitching tieavbindningspunktafbindningspunktaukabindipunkturlujituspisteZwischenbindungpoint de couture
anbindetrådarstitching ends or pickssammenbindingstrådermellembindetrådeaukabindiþræðiryhdistävät langatZusatzkettefils ou coups de liage
appretyrdressingappreturappretursteiningviimeistysAppreturapprêt
avbindetrådarauxiliary bindning ends or picksbindetråderafbindetrådebindiþræðirlujitelangatzusätzliche Bindungenfils de liage
avfallssilkewaste silkavfallssilkeaffaldssilkesilkitrefjursikkijäteAbfallseidedéchets de soie
avigsidareversevrangevrangsideranghverfanurija puoliUnterseiteenvers
avkoktdegummedavkoktafkogtsoðiðkeitetty silkkientbastetdécrusé
bandgrindrigid heddlebåndgrindvævespjeldbandgrindnauhapirtavebgittergrille à tisser
bandknivknifebåndknivbåndknivskeiðnauhalastavebmesserlatte
bandnålband-shuttlebåndvevskyttelbåndskyttebandnålnauhakäpyvebnadelplate-navette
bandvarpa (s)warping framerenneapparat til bebynnelseskanttrendebuk for opret væktvævrakgrindnauhan luontitelineshärbock für Gewichtswebstuhluordissoir pour chaîne à lisière transversale
bandvävstolband-loombåndvevbåndvævbandvefstóllnauhapuutbandwebstuhlmétier à ruban
batikbatikbatikbatíkbatikbatikkibatikbatik
bayadère (fr)-------
begynnelsebandstarting borderbåndvevd begynnelseskantbegyndelsebåndupphafsjaðaralotusnauhawebekantelisiere transversale
beiderwandtied doubleclothbeiderwandbeiderwandþýzkur bindiþráðavefnaðurbeiderwandbeiderwandbeiderwand
bindemönsterdraftbindemønsterbindemønsterbindimunsturkankaankuvabindungsrapporttracé graphique
bindepunktpoint of bindingbindepunktbindipunktbindipunktursidospistebindungspunktpoint de liage
bindeskaftbinding harnessbindeskaftbindeskaftbindiþráðasköftsidelankavarsivorgeschirrlisses de liage
bindevarpbinding warpbindevarpbindekædebindiuppistaðasideloimibindekettechaîne de liage
bindning Ibindingbindingbindingbindingsidosbindungcroisement
bindning IIweavebindingbindingvendsitoutuminenbindungsartarmure
bindningsmönstradself-patternedbindingsmønstretbindingsmønstretsamsett bindingsidoskuviollinendamastartigdamassé
bindningsrapportweave unitbinderapportbindingsrapportmunstureindperusruutubindungsrapportrapport d'armure
blångarntow yarnstrygarnblårgarnstrýgarnrohdinlankawerggarnfil d'étoupe
blångarnslärfttow clothstrylerretblårlærredhörstrigirohdinpalttinawergleinwandtoile d'étoupe
blånortowstryblårstrýrohtimetwergétoupe
bobincage-spoolbombobinebalbínakehäbobinebobine
bombeambombomrifurpuomibaumrouleau
bomskedraddlesveipeskjeredekamforskeiðkäärinpirtareedekammpeigne de mise
bomullcottonbomullbomuldbómullpuuvillabaumwollecoton
bottengroundbunnbundgrunnurpohjafondfond
botteninslagmain weftbunninnslagbundinslagundirbandpohjankudegrundschusstrame de fond
bottenskaftground harnessbunnskaftbundskaftgrunnsköftpohjavarretgroundharnischremisse de fond
bottenullwoolbunnullbunduldþelalusvillaflaumhaareduvet
bottenvarpmain warpbunnvarpbundkædeundirþræðirpohjaloimihauptkettechaîne pièce
bottenvävground fabricbunnbindingbundvævgrunnbindingpohjakudosgrundgewebetissu de fond
bouclêbouclébouclébouclélykkjufloshelmisidosNoppengewebebouclé par la trame
bourettesilkebourrettebourettesilkebourettesilke-bourettisilkibourrettebourrette
brant stigninghigh angledsteil skråningstejlkipperbrött skálínajyrkkä nousuneigung-
breddwithvevbreddevævebreddebreiddkankaanleveyswarenbreitelaize
brickbandtablet-woven bandbrikkebåndbrikbåndspjaldofið bandlautanauhabrettchenbandgalon tissé aux cartons
brickvävningtablet weavingbrikkevevingbrikvævningspjaldvefnaðurlaudoillabrettchenwebereitissage aux cartons
brokadbrocadebrokadebrokadebrókaðibrokadibrokatbrocart
brokadskyttelbrocading shuttlebrokadeskyttelbrokadeskyttelbrókaðinálbrokadinsukkulabroschierschützeespolin
brokatellbrocatellebrokatellbrocatelle-brokatellbrokatellbrocatelle
broscherat inslagbrocading weftbrosjert innslagbrocheret indslagbrugðið munsturbandpujotuskudebroschierschusstrame brochée
bruten kypertbroken twillbrutt kypertbrudt kipperskekkt vaðmálmurtotoimikasköperbindungsergé brisé
bråka (s)brakebråkbrydebrákstokkurpellavaloukkuflachsbrechemacque
bröstbombrest beambrystbombrystbombrjóstslárintapuubrustbaumpointrinière
bältesvävbody-tension loombody-tension loom=enbody-tension loommittisverfurbody-tension loomgürtelwebgerätmétier à ceinture
chinéchinéchinéchiné-chinéchinéchiné
cordonnetsilkecordonnetcordonnetsilkecordonetsilkestrengjasilkikordonnetisilkkikordonnetcordonnet
daldrällovershot weavehalvdreieldaldrejldaladregilltaalainsidosleinwandbindung mit lancierschusstoile lancée
damastdamaskdamaskdamaskdamaskdamastidamastdamas
denierdenierdenierdenierdeníerdenierdenierdenier
diamantkypertbroken lozenge twilldiamantkypertkrystalkipperskekkt hringavaðmálruudullinendiamantköperlosange
diasperlampasdiasperdiasper-diasperdiasperlampas
dockabutterflydukkedukkeskilhönksormiobüschelpeloton de trame
dragen trådwiretrukken tråddragen tråddreginn wírvedetty metallilankametalldrahttrait
dragrustningshaft draw systemdragrustningdragrustningdragskeftavetolaite-système de tire à baguettes
dragsnöreSimple corddragsnøredragsnordragsnærivetonyörizampelschnurcorde du semple
dragsvendrawboydragsvenn=sv.dragsvend-vetäjäpoikazugjungetireur de lacs
dragvävstoldrawloomvev med dragningsapparatvæv med dragrustningdamasktóllvetokangaspuutzugwebstuhlmétier à la tire
droppdrällself-patterned tabbybyggkornbygkornsprangdregillnastallinen kudosgerstenkorngranité
drälltwill diaperdreieldrejldregillkilpikangasatlasdamassé
dubbelsidigreversiblevendbardobbeltsidetmisbyrtkaksipuolinenreversibeldouble-face
dubbelsidiga bindningardouble-faced weavesdobbeltsidige bindingerdobbeltsidede bindingertvöfaldar bindingarkaksipuoliset sidoksetdoppelseitige gewebearmures doubles-faces
dubbeltvinnat garncabled yarndobbeltvunnet garndobbeltvundet garntvímargtvinnað bandkaapelikierteinen lankamehrfachzwirncablé
dubbelväv Ipick-up doubleclothdobbeltvevdobbeltvævfinnskur vefnaðurtäkänädoppelgewebetaffetas double-étoffe façonée
dubbelväv IIdouble weavedobbeltvevdobbeltvævtvöfaldur vefnaðurkaksinkertaiset yhteensidotut kankaatdoppelgewebedouble-étoffe
dubbleringdoublingdubleringdubleringþætta (v)kierteen antofachen (v)doublage
dukagångbrocaded on the counted threadsjonbragdddukagangglitvefnaðurpintapujotus-toile brochée à liage vertical
dupiondoupiondupiondupion-dupiondoupiondouppion
effekteffecteffekteffektáferöpintavaikutelmaeffekteffet
enkel trådendenkelt trådenkel trådþátturkertaamaton lankaeinzelfadenbout
enkeltrådbrinenkeltrådenkeltrådeinfaldur þráðurkokonkilangan ydinsäiekernfadenbrin
fasta varptrådarfixed warp endsgrunntrådergrundtrådefastaþræðirperusloimilangatstehkettfädenfils droits
fiberfibrefiberfibertrejfakuitufaserfibre
fibroinfibroinfibroinfibroinfíbróínfibroiinifibroinfibroïne
filerat silkepoilfor-tvunnet grègesilkefileret silke-kierretty grègesilkkipelseidepoil
fileringtwistingfor-tvinningfilering-grègesilkin kiertomulinierentorsion
filtfeltfiltfiltflókihuopafilzfeutre
flack stigninglow angled (a)slak skråninglav stigninglág skálínaloiva nousuneigung-
flamgarnchinéflammegarnombundet garnreyrt garnflammulankaflammengarnchiné
flamskvävtapestrybilledvev i gobelinteknikkflamskvævningmyndvefnaðurkuvakudoswirkereitapissierie
flockflossflokksilkeflocksilke-silkkijäteflockseidefrisons
flossaknotted pile fabricflossflosflosryijykudosknüpftechniktapis noué
flossilkeflossfilofloss-silkeflossilkeflokksilkikertaamaton kirjontasilkkifilofloss-seidefloche
flotterafloatflottereflotteremynda lausaslöngurmuodostaa nastojaflottierenflotter
flotteringfloatflotteringflotteringlausaslöngurlankajuoksuflottierungflotté
fotvävning---fótvefnaður---
friségarnspiralspiralgarnspiralgarnhrokkið garnondélankaondégarnondé
friséguldfriséfriségullfriséguld-frisékultafriséfrisé
fyllnadsinslagwadding weftfyllveftfyldskudfyllingarívaftäytekudefüllschusstrame de bourré
fyllnadsvarpwadding warpfyllvarpfyldkædefyllingarþráðurtäyteloimifüllkettechaîne de bourré
fyrskaft4--end twillfirskaftfirskaftferskeftaneliniitinen toimikasköperserge de 4
fyrskaftad4-end weavefirskaftetfirskaftetferskeftneliniitinen4-bindigarmure de 4
färgat råsilkesilk dyed in the gumfarget råsilkefarvet råsilkelitað hrásilkivärjätty raakasilkkiseidecru
förskjutendrop repeatforskjøvetforskudtskekktursiirrettyversetztcontresemplé
förstorad bindningextended weaveavledet bindingforstørret bindingstækkuð bindingsuurennettu sidosbindungarmure derivée de
förtyngningweightingfortyngningbetyngningþyngingsilkinpainotusbeschwerungcharge
garnyarngarngarngarnlankagarnfil
garnnummeryarn countgarnnummergarnnummergarnnúmerlangannumerogarnnummernuméro
garnvindaswiftgarnvindegarnvindevindakerinpuutgarnwindedévidoir
gasbindninggauzeslyngevevgazebindingnetvefnaður1) lintuniisikangasdreherbindunggaze anglaise
gassolvdoupslynghovlergazesøllerhöföld fyrir netvafnaðlintuniidetbaumwoll-litzelisse anglaise
genombrutenopen-workgjennombruttgennembrudtopin áferðreiällinendurchbrochenajouré
genomskärningprofilelengde- og tverrsnittlængde - og tværsnitþverskurðurpoikkileikkausgewebschnittprofil
glesrandbarred (a)glyttebæltevígindaber (a)harvakuteinen raitaschusstreiffenclaire (a)
glättadglazedglansetglittetgljáðkalanteroitugeglänztlustré
gobelängvävtapestry weavegobelingobelinmyndvefnaðurgobeliinikudoswirkereitapissierie
gobelängvävstolhigh-warp loombilledvevstolflamskvævmyndvefstóllgobeliininpuuthochwebstuhlmétier de tapisserie
gobelängvävstol horisontelllow-warp tapestry loomhorisontal gobelinvevstolhorisontal gobelinvævstolláréttur myndvefstóllvaakataso-gobeliininpuutbasselissestuhlmétier à basse-lisse
graderad kypertcomposite twillgradert kypertgraderet kiper-epätasaraitainen tomikasmehrgratköpersergé composé
grègesilkegrègegrègesilkegrègehrásilkigrègesilkkigrègegrège
grenadingrenadinegrenadingrenadine-grenadiinigrenadinegrenadine
grundbindningarbasic binding systemgrunnbindingergrundbindingerfrumbindingarperussidoksetgrundbindungenarmures fondamentales
gåsögonlozenge twillgåseøyegåseøjehringavaðmálristitoimikasrautenköperlosange
halvflossavoided pile fabrichalvflosshalvflosrósaflospuoliryijyNoppengewebe-
halvkrabbabrocaded tabby/type "halvkrabba"blokkvevhalvkrabbahálfglitjuoksupujotus-toile brochée/ type "halvkrabba"
halvt förskjutenhalf-drop repeathalvt forskjøvethalvt forskudtskekkt till hálfspuoliksi siirrettyin halbversatzcontresemple
hampahemphamphamphampurhamppuhanfchanvre
handvävstolhand loomhåndvevstolhandvævhandvefstóllkäsikangaspuuthandwebstuhlmétier à bras
hankfärgadyarn-dyedgarnfargetfedfarvetgarnlitaðlankana värjättystranggefärbtteint en fil
harneskbrädacomber boardharniskbrettharniskbrædt-harneskin reikälautaharnischbrettplanche d'arcades
harneskrustningdrawloom figure harnessharniskrustningharniskrustning-harnesklaiteharnisch des zugwebstuhlscorps de maillons
harnesksnörepulley cord + tail cordharnisksnøreharnisksnor-harnesknyöricolletschnur + zugschnur oder rahmencordecorde du rame
harnesksolvleashharniskhovelharnisksølle-harneskpuiden kuvioniidetlitzemaille
harneskuppknytningharness tieharniskoppknyttingharniskoppbinding-harnesknyörien sidontabeschnürungempoutage + colletage
haspelreelsilkehaspehaspetræhesputrévyyhteämiskelahaspelguindre
hasplareelhesplehaspehespakelatahaspelndévider
havssilkepinnamuslingsilkemuslingesilkesjávarsilkimersilkkimuschelseidesoie de coquillage
hoppande solvning-overspringende hovlinghoppende sølningstökkinndrátturhajoitettu niisintäeinziehenremettage amalgamé
hålkrus-hullbragdhulpiketkniplingsvefnaðurpitsisidos--
häckla (v, s)hacklehekleheglekemba línhäkilöidähechelnsérancer
härledd bindningweave derived from --avledet bindingaflet bindingafbrigði af frumbindingujohdettu sidosbindungarmure dérivée de --
härvaskeinhespelfedhespavyyhtistrangécheveau
härvelreelhespetrehaspetræhesputrévyyhdinpuuhaspeldévidoir
hästhorsehestvippevippahevonenwippe-
ikatikatikatikatíkatikatikatikat
indragningdraw ininnvevingindvævningvoðin vefst innleveyden kutistumineneinwebenétranglement de lisière
inplockat inslagtapestry weftsmettet bunninnslagafbrudt el. partivis indplukket indslagbrugðið ívafpoimittu kudehandeintragtrame inserée à la main
inplockat mönsterinslagbrocading weftsmettet mønsterinnslagindplukket mønstertrådbrugðið munsturbandpoimittu kuviokudebroschierschusstrame brochée
inredningbuilding the montureoppsettingopsætninguppsetningkankaan rakentamineneinrichtungmontage
inräkningreading inmønsterordning i dragrenningindtællingúttalningvetonyörien jako kuvio-osiineinlesenlisage
inräkningsfelreading errorfeil i mønsterordningenindtællingsfejlskekkja í úttalningulaskuvihre konepuissaeinlesefehlerfaute de lisage
inslagshuttlinginnslagskudfyrirdragkuteenheittoschusstreiffencoup
inslagweftinnslagskudívafkudeschusstrame
inslagseffektweft-facedinnslagseffektislæteffektbandáferðkudevaltaisuusschussbindungeffet de trame
inslagsfelshuttling errorinnslagsfeilskudfejlstigskekkjakudevirheeintragfehlerfaute de navetage
inslagsflotteringweft floatsprangskudflotteringlausaslöngur í ívafikudejouksuschussflottierungflotté de trame
inslagskypertweft-faced twillinnslagskypertindslagskippervaðmál með bandáferðkudetoimikasschussköpersergé face trame
inslagskypert med två varparweft-faced compound twillinnslagskypert med to varp = svsamitum-samitumschussköper mit zwei kettensamit
inslagslinjefellinnslagskantindslagslinjevefaðsbrúnkankaansuuanschlagstelleligne de serrage la trame
inslagsmistamissing weftmanglende innslagmanglende indslagstigskekkjapyyttuva kudeschussfadenpas failli
inslagsordningshuttling orderinnslagsordningindslagsordenívafsumferðkudeohjeschussfolgenavettage
inslagspinnetapestry bobbininnlagspinne = svgobelinpindgóbel+inpinnikuvakudospuikko-broche
inslagsrapportpassrapport i innslagsretningsludrapportívafsumferðkuteen mallikertapasséepassée
inslagsripsweft ribbed fabricinnslagsripsskudrepsívafsbrekánkuderipsischussripsreps
inslagssammetvelveteeninnslagsfløyelskudfløjlflauelkudesamettischuss-samtvelvet
inslagssatinweft-faced satininnslagssatengskudsatinbandsatínkudepomsischussatlassatin trame
inslagssidaweft faceinnslagssideislætsideborð með bandáferðkudevaltainen puolischusseiteface trame
inslagssilketramtrameindslagssilkeívafssilkikudesilkkitrametrame
inslagsstickarug shuttlefilleskyttelkludeskytteteppanálmattopäreeintragsstabnvette
inslagstråd Ipick-up doubleclothinnslagstrådislættrådfyrirdragkudelankaschussfadencoup, duite
inslagstråd IIlatinnslagstrådislættrådfyrirdragkudelankaschussfadenlat
inslagstuskaftweft-faced tabbyinnslagstoskaft-hlaðveftuð einskeftalöyhä kuderipsi-taffetas dominante trame
inslagstuskaft med två varparweft-faced compound tabbyinnslagstoskaft med to varp = svskudmönstret toskaft med fyldekæde-täyteloimiset kuderipsitzweikettige schuss-leiwandtaqueté façonné
inslagsvävnader med två varparweft-faced compound weavesinnslagsvevnader med to varp = svskudemönstrede vævninger på to rendinger-side- ja täyteloimiset kudevaltaiset kankaatschussbindungen mit zwei kettentaqueté façonné
invävningtake upinnvevningssvinn på lengdenindvævning på længdenstyttingloimen kutistumisvaraeinsprungembuvage
jacquardvävstoljacquard loomjacquardvevstoljacquardvævjacquardvefstólljacquard-kangaspuutjasquardmaschinemétier jacquard
jutejutejutejutejútajuuttijutejute
k'o-ssuk'o-ssuk'o-ssuk'o-ssu-k'o-ssuk'o-ssuk'o-sseu
kamgarnworsted yarnkamgarnkamgarnkambgarnkampalankakammgarnfil de laine beignée
kamningoombingkjemmingkæmningkembingvillankampauskämmenpeignage
kardningcardingkardingkartningkembingkarttauskardierencardage
kardorcardskarderkarderkambar1) villakarttakardätschencardes
kardrullesliverkardetulltøjekemba línhahtuvaflockeruban de carde
kashmirullcashmere woolkashmirullkashmir-uldkasmírullkashmirvillakaschmirwollecachemire
kedjachained spacing cordfitjetrådlænkefitketjusilmukkarivikettenordnercordon envergeur
kelimkilimkelimkelimkelímvefnaðurkelim-pujotuskelimkelim
klädebroadclothkledeklædeklæðiverkatuchdrap
kokongcocoonkokongkokonpúpuhýðikokonkikokoncocon
kokongtrådbavekokongtrådkokontrådpúpuþráðurkokonkilankakokonfadenbrave
kontramarschcountermarchkontramarsjkontramarchgagnbindingvipukangaspuutkontermarschcontre-marche
kontraskälopposite shedkontraskillkontraskelgagnstætt skilpäinvastainen viriögegenfachfoule inverse
korskypertbroken twillkorskypertkorskippervíxlað vaðmálvalepomsiköpersatin de 4
kortlattorlamsvekslerkorte sideskamlerefri lágskemlarauttajatquerholz-
krabbasnårbrocaded tabby/type "krabbasnår"vestfoldsmettkrabbasnårskakkaglitjuoksupujotus-toile brochée / type "krabbasnår"
kräppcrepekreppgarnkrepgarnkrepgarnkreppilankakreppcrêpe
kyperttwillkypertkippervaðmáltoimikasköperbindungsergé
kägelvävstol-keglevev = dakeglevæv--kegelwebstuhlmétier aux boutons
kärnacorekjernetrådsjælgarnmergursydänsäieseeleâme
lagn/langporteerenslelaggangurloimisisarusgangbranche
lamélamélamélamévírofið efnilameelamélamé
lanlamellalanlahnflatur vírlattalankalahnlame
lanserat inslagpattern weftlansert innslaglanceret indslagskyttudregið yfirbandsukkulalla heitetty kuviokudelancierschusstrame lancée
lattorlamsvekslersideskamlerskemlarvälittäjäthebelleviers
liggande varphorizontal warpliggende varpliggende trendlárétt uppistaðavaakatasoloimikettechaîne horizontale
liksidigreversiblelikesidigligesideteinsbyrttasapuolinenbeidseitigsans-envers
limmasizelimelimelímberaliimata lointaleimenparer
linflaxlinhørlínpellavaflachslin
linnelinenlingarnlinnedlín-pellavalankaleinenlin
locklashløkkeløkke-harneskloimen vetosilmukatlatzlac
lodlingoloddlodlóðpainoniisien painotlitzengewichtplomb
luddnaploluvpintanukkaflorduveté
luggpilenappluvflospystynukkaflorpoil
lunapulleytrinseblokktrissesamsett trissaorsipyöräblockchape et poulies
lyftande skaftlifting shaftskaft som hevesløftende skafthækkað skaftnouseva niisivarsihochschaftlisse de levée
långlattorlower lamskontravekslerlange sideskamlerneðri lágslemlarpitkät alavälittäjätquertrittecarquerons
långrandigstripedlangstripetlængdestribetlangröndóttpitkinraitanengestreiftrayé
långrockgreat wheelskottrokklangrokskotrokkurpitkärukkihandradrouet
lärftlinen tabbylerretlærredléreftpalttinaleinwandtoile de lin
maskinvävstolpower loommekanisk vevstolmaskinvævvélvefstóllkutomakonewebstuhlmétier mécanique
meleradjaspémelertmeleretyrjóttmeleerattujaspéjaspé
membranguldgilt or silvered membrane or leather stripmembrangullmembranguldgullskænimembraanikultahäutchengold/silber-fadenlamelle de baudruche
metalltrådmetal threadmetalltrådmetaltrådvírofið efnimetallilankametallfadenfil métallique
metriskt nummercountermarchmetrisk nummermetrisk nummerlengdarnúmermetrinen numeronummernuméro métrique
mjukt silkedegummed silkavkokt silkeafkogt silkesoðið silkipehmennetty silkkiseidesoie cuite
moarémoirémoarémoiréskýjaðmoareemoirémoiré
mohairmohairmohairmohairangóraullmohairmohärmohaire
munkabältemonk's belttavlebragdmunkebortsalún1. souraruutuinen kudekuviollinen raanukudos-toile lancée type "munkabälte"
myggtjällmock lenomyggtjeldmygtjælkóngulóarvefnaðurkanavascheindrehergewebefusse gaze
mönsterpatternmønstermønstermunsturkuviomusterdessin
mönsterinslagpattern weftmønsterinnslagmønsterindslagyfirbandkuviokudeziershusstrame de décor lancée ou brochée
mönsterrapportpattern unitmønsterrapportmønsterrapportmunsturumferðkuvionmallikertamunsterrapportrapport de dessin
mönsterskaftshaft figure harnessmønsterskaftmønsterskaftmunstursköftkuviovarretmunsterharnischcorps de lisses de dessin
mönstervarpflushing warpmønstervarpmønstertrendmunsturþræðirkuviolomiflottierkettechaîne poil
mötande varpopen-circular warpmøtende varp for rundvevmødende trend for rundvævvíxlvafin uppistaðarengasloimi-chaîne à extrémités jointives
naturfärgatundyednaturfarvetnaturfarvetólitaðluonnvärinenungefärbtécru
naturligt skälnatural shednaturligt skillnaturligt skellágluonnollinen viriöfachfoule par baton fixe
nockaknotnappknuderöggnukkaknotennoed
nystanballnøstenøglehnykillkeräknäuelpelote
nässlanettleneslenældenettlanokkonennesselortie
nättelduknettle clothnettelduknetteldugnettludúkurnokkospalttinanesseltuch-
nöthårcow hairnauthårfæhårkýrhárnaudankarvakuhhaarpoils de boeuf
odlat silkesilkekte silkeægte silkeræktað silkiaito silkkiseidesoie
omvänd rapportreversing comber unitomvendt rapportomvendt rapport-käännetty mallikertafadenrapportchemin à retour
opphämta-skillbragdopphemtaskilskefta1. kudekuviollinen silmikko--
oppstadgognwarp-weighted loomoppstadgognoppret vagtvævvefstaðurloimipainoiset kangaspuutgewichtswebstuhlmétier à poids
oregelbunden satinirregular satinuekte satengureglemæssig satinóreglulegt satínepäsäännöllinen pomsiatlasbindungsatin irrégulier
oskuren sammetuncut velvetuskåret fløjeloupskåret fløjllykkjuflauelleillaamaton samettisamtvelours frisé
ospunnentwistlessuspunnetuspundetóspunniðkehräämätön kuituungedrehtsans torsion
panamaextended tabbypanamapanamajafavendpanamapanamabindungnatté
pappersguldgilt or silvered paper strippapirgullpapirguldbréfgullkulta- lpapiergoldfadenlamelle de papier
pasmacutfeddfedskreppapasmagebindeéchevette
patronpoint paper planrutetegningpatronbindimunstursidospiirustuspatronemise en carte
plyschplushplysjplysplussplyysiplüschpeluche
polskottpile weftpolveftpolskudflosívafkudesametin nukkakudeflorschusstrame supplémentaire formant poil
poltrådardoup warpslyngetråderslyngetrådebindiþræðirkiertolangatdreherkettenfadenfils de tour
polvarppile warppolvarppolkædeflosuppistaðasametin nukkaloimiflorkettechaîne poil
pressatgaufferedgauffrertpressetstimpilmunstraðkohokuvioitugaufriertgaufré
påsvävtubular fabricrundvevsækkevævpokavoðletkuschlauchgewebetissu tubulaire
rak eller genomgående solvningstraight enteringrett gjennomgående hovlingsølning lige overbeinn indráttursuora niisintäpassierungremettage suivi
rak följdcomber repeatrett rekkefølgelige overbeint framhaldaiheen suora niisintämunsterrapportempoutage suivi
rak rapportstraight comber unitrett gjennomgående rapportlige rapport-aiheen suora niisintämunsterrapportchemin suivi
ramiramieramiramieramíramiramieramie
rapportbreddcomber unitrapportbredderapportbredde-mallikerran leveysfadenrapportchemin
redkamraddlesveipkamredekamvefjarkamburkäärimäkaideaufziehekammrâteau
relationproportionproporsjontrådforholdhlutfallsuhdeverhältnisproportion
reliefsammetpile on pile velvetrelieffløyelrelieffløjlupphleypt flauelreliefisammettireliefsamtvelours relevé
ribbaribribberibbegárikohoraitarippecôte
rikt mönstrad kyperthigh-harness lozenge twillkypertvartkippervariation-koristeellinen ristitoimikasrautenköperlosanges à grand développement
ripsribbed fabricripsrepsbrékanripsiripsreps
ripsartadribbedripsartetrifletgáróttripsimäinengeripptcôtelé
rockhuvuddistaffrokkehoderokrokkurrukinlaparockenquenouille
rosengångrosepathrosebragdrosengangrósabandavefnaðurruusukas"rosengång"tissue type "rosengång"
rugga uppnapruerueýfakartatarauhenlainer
rullramspool-racksnellestativtenstativbalbínustóllrullatelinespulenrahmencantre
rundvävtubular fabridrundvevd tøyrundvævhringvoðpyörökudosrundgewebetissu fermé
rustningmonturerustningredskab-kangaspuidengeschirrmontage
ryapile rugryeryaröggvarfeldurryijyryatapis noué
rätsidafceretteretsiderétthverfaoikea puolioberseiteendroit
rätvarpawarping boardvarprammetrenderammerakgrindluontikehikkoschärrahmenourdissoir
rölakantapestry type "rölakan"rutevevrølakankrossvefnaðurkiintopujotuswirkereitapissiere type "rölakan"
rördenttindrittönnpiinvälirietlückedent
rötningrettingrøytingrødningfeyskjunliotusrottenrouissage
s-spunnets spuns-spunnets-spundets-spunniðs-kierteinens-gedrehttors s
sammansatta vävnaderlampassammensatte vevnaderbindningsmønstrede vævningersamsettir vefirvahvistetut sidoksetlampaslampas
sammetvelvetfløyelfløjlflauelsamettikettsamtvelours
sammet med pressat mönsterstamped velvetfløyel med presset mønsterfløjl med presset mønsterstimpilmunstrað flauelprässäyskuviollinen samettisamtvelours frappé
satinsatinsatengsatinsatínpomsiatlasbindungsatin
schappeschappeschappeschappesilke-shappesilkkischappeseideschappe
sericingum sericinserisinsericinsilkilímserisiiniserizingrès
sidensilksilkesilkesilkisilkkikangasseideétoffe de soie
silkesilksilkesilkesilkisilkkilankaseidesoie
silkesmasksilkwormsilkeormsilkeormsilkiormursilkkimatoseidenraupever à soie
silkesodlingsericulturesilkeavlsilkeavlsilkiræktsilkinviljelyseidenzuchtsériciculture
silkespinnerifilaturesilkespinnerisilkespinderi-silkkikehräämöseidenspinnereifilature
silkespinningreelingsilkespinningsilkespindingsilkispunisilkin kehruuhaspelnfilage
silketvinningthrowingmoulineringsilketvindning-silkin toinen kertausmulinierenmoulinage
sisalhampasisalsisalhampsisalhampsísalsisalhamppusisalsisal
skaftshaftskaftsølleskaftskaftniisivarsischaftlisse
skaftgruppharnessskaftgruppeskaftgruppeskaftasamstæðaniisivarsiryhmägeschirrremisse
skaftkäpparheddle barsskaftkjeppersølleskafthafaldasköftniisivarvatschaftleistenlisserons
skaftvävstolshaft loomflatvevskaftvævvefstóllpyöräskangaspuutflachwebstuhlmétier à lisses
skarp anslutning-skarp grenseskarp afbindinggagnstæð bindingjyrkkä leikkausviivagegenbindungopposition de liage
skedkrokreed hookskjekrokrittebladgikkurpirtakoukkueinziehmesserpassette
skedningsleyingtreing av skjeentrække i rørdraga í skeiðpirtaan pujotusrietstechenpiquage en peigne
skiftandeshotchangeantchangerendelithverfurvivahtelevachangeantglacé
skridningstalinterruptionskridningstallskridningstalstigtalanuosulukufortschreitungszahldécochement
skuggadhatchedsjattertskyggetskyggthäivytettyschattiertombré
skuren sammetcut velvetskåret fløyeloppskåret fløjlskorið flauelleikattu samettisamt, aufgeschnittenvelours coupé
skyttelshuttleskyttelskyttelskyttasukkulaschützenavette
skyttlat inslagshuttled weft threadskytlet innslagskyttet indslagskyttudregið ívafsukkulalla heitetty kudeschützeneintragtrame passée avec une navette
skäktefallscutching towskakestryskættefaldstrýlihtaustappuratwergétoupe
skäktefallsgarnscutching tow yarnskakestrygarnskættefaldsgarnstrýgarntappurarihmahedegarnfil d'étoupe
skäktträscutching knifeskakeknivskættehåndþusturvidinveitsischwingmesserteilloir
skälshedskillskelskilviriöfachpas
skälbildande apparatshedding mechanismskilldannenderedskabet-viriönmuodostuslaitteetfachbildungsvorrochtungorganes de commande
skälbladpick-up stickskillbladskelbladskilfjölpoimintalastawebschwertepée
skälfelshedding faultuklart skilluklart skelóhreint skilvirheellinen viriöfachfehlerkäl beroende
skälkäppshed rodskillskafttrendestavskilfjölviriövarpatrennstabbâton de croisure
skälsprötcross sticksskillstikkerskelkæppeskilsköfttiuhtavarvatkreuzstäbebaugettes d'envergeure
skävorshivestosagnerskæverlíntrospäistäreetschabenchènevotte
slagbombeaterslagbomslagbordslagborðluhakammladebattant
sländaspindlehåndteinhåndtenhalasnældavärttinähandspindelfuseau
sländtrissaspindle-whorlhåndteinsnelletenvægtsnældusnúðurvärttinänkehräspinnwirtelfusaïole
slätplainumønstretsletvævsléttursileäglattuni
slät sammetsolid velvetumønstret fløyelglat fløjlómunstrað flauelsileä samettisamtvelours uni
sniljachenillechenilleseniljeflosræmachenillelankachenillechenille
snoddtwistsnusnoningsnúðurkierretty grègesilkkidrehungtorsion
snärjt inslagsoumak weftsoumak-innslagsnærjet indslagstrådvarpleggsívafkiertopujotuskudesumakhfadentrame de soumak
snärjvävsoumaksoumaksnærjevævofinn varpleggurkiertopujotussumakhsoumak
solvheddlehovelsølleskafthafaldniisilitzemaille
solvaenterhovlesölledraga í höföldniisiäeinziehenremettre
solvfelthreadding errorfeil i hovlingensøllefejlinndráttargalliniisintävirhepassierfehlerfaute de remettage
solvningenteringhovlingsølninghafaldainndrátturniisintäeinzugremettage
solvning i partier-partivis hovlingpartisølningkaflainndrátturryhmittäinen niisintäeinzugremettage interrompu
solvning i spetsreverse enteringspiss hovlingsølning i spidsoddainndrátturkärkiniisintäspitzinzugremettage à pointe
solvnotadrafthovellistesøllenoteinndráttarmunsturniisintäohjepatronetrancé de remettage
solvskaftheddle rodhovelskaftsøllestanglaust hafaldaskaftirtoniisivarpalitzenstabperche à lisses
souplesilkesouplesouplesilkesouplesilke-souplesilkkisouple-seidesouple
spegelvändpoint repeatspeilvendtspejlevendtsamhverftpeilattu mallikertagegenläufigdessin à pointe
spetsinredningreverse repeattredd i spisssølning i spidsoddainndrátturkärkiniisintämusterrapportmontage à pointe
spetskypertchevron twillspisskypertspidskipperoddavaðmálkärkitoimikasspitzgratköperchevron
spindelspindleteinspindelsnældakehrävarsispindelfuseau
spinningspinningspinningspindingspunikehruuspinnenfilage
spinnrockspinning-wheelrokkrokrokkurrukkispinnradrouet
spinnrullespoolrokkesnellespolerokksnældarukinrullaspulenrahmenbobine
spiralvarpspiral warpspiralvarp = svspiralkæde for rundvævsívafin uppistaðapyöröloimiendlose kettechaîne en spirale
spolebobbinspolespolespólapuolaschusspulecanette
spunnen metalltrådfiléspunnet metalltrådspundet metalltrådmálmgarnkehrätty metallilankagimpefilé
spunnet silkespun silkspunnet silkespundet silkesilkitrefjurkehrätty silkkijäteseidefilés de soie
spännaretemplespjelksprederspjálkpingotinbreithaltertemplet
stadkantselvagejaresidekantjaðarhulpiowebekantelisière
stadkordongselvage cordjareforsterkning med snorkantsnorjaðarstyrkinghulpion vahvistuslankaleistenfadencordeline
stavvekvet rodnålruteflosteinnnukkarauta (sametin kudonnassa)samtrutefer
stickelhårkempdaudhårstikhårillhærurkuollut karvastickelhaarepoils morts
stigninginclinationskråningstigningbrattinousuneigungswinkelinclinasion
stroppnecking cordstroppstrop-harneskniiden jatkoharnischschnurarcade
strukturconstuctionstrukturstrukturgerðstruktuurigewebestrukturcontexture
sträckbomback beamstrekkbomstrækbomspennisláselkäpuustreichbaumrouleau porte-filis
strängfilamentfilamenttrådþraðurfilamenttifadenfilament
styckfärgadpiece-dyedstykkfargetstykfarvetdúklitaðkappalevärjättystückgefärbtteint en pièce
stygndecopurestingstingsporkuvion pistestufungdécopure
stående varpvertical warpstående varpopret trendlóðrett uppistaðapysty loimikettechaîne verticale
svepabeamsveipeskjebommerifjakiertää lointa tukilleaufbäumenplier
svepningbeamingsveipingbomningrifjunloimen kiertäminen tukilleaufbäumenpliage
sänkande skaftdepression shaftskaft som senkessænkende skaftlækkað skaftlaskeva niisivarsitiefschaftlisse de rabat
tagelhorsehairhestetaglhestehårhrosshárjouhirosshaarcrin
tandtoothtindrørtönnpirranpiirietdent
tandaddovetailedhakkethakketgeirofiðhammastettu liitosverzahnte-
textiltextiletekstiltekstiltextílltekstiilitextiltextile
texturtextureteksturteksturáferðtekstuuri-texture
tillslagningbeating intilslagslagningslátturkuteenlyöntianschlagtasssement
topplattorcoupersvippervipperháskemlarvipusetwippen-
trampatreadletrøetrampeskammelpolkunentrittmarche
trampordningshedding ordertrøingsordningtrædningsordenstigmunsturpoljentaohjetrittfolgeordre de marchure
tredubbel vävtriple weavetredobbelt vevtredobbelt vævningþrefaldur vefnaðurkolminkertainen kangasdreifachgewebetriple-étoffe
trissbrädepulley boxtrinserammetrissbrædt-vetolaitteen rissalautarahmenbrettcassin
trissorpulleystrinsertrissertrissurpyöräsetrollenpoulies
trådthreadtrådtrådþráðurlankafadenfil
trådtäthetthread counttrådtetthettrådtalþráðatalalankatiheysfadenzahlréduction
tuskafttabbytoskaftbindingtoskaftsbindingeinskaftakaksiniitinenleinwandbindungtaffetas
tussahsilketussahtussahsilketussah-silkevillisilkitussahsilkkitussahtussah
tvinnaplytvinnetvindetvinnakerratamulinierenretordre
tvinnat garnplied yarntvunnet garntvundet garntvinnað bandkerrattu lankazwirnretors
tvinnat silkethrown silktvunnet silketvundet silkesnúrusilkikerrattu silkkimulegarnesoie moulinée
tvåtrådigt2-plytolagttotrådettvíþættkaksisäikeinenzweifachzwirn2 bouts
tvärrandigbandedtverrstripettværstribetþverröndóttpoikkiraitainengebändertbarré
tygfabrictøytøjevoðkangasstoffétoffe
tygbomcloth beamtøybomtøjbomklæðarifurkangastukkiwarenbaumrouleau d'étoffe
tågorbast bundleslintagltaverlíntrefjurkuidut-filasse
täckullhairdekkhårdækhårtogpeitinvillagrannenhaarepoils
tätrandbarred (a)tettrandbæltet (a)veftaður (a)tiheä raitaschusstreifenserrée (a)
ullwoolulluldullvillawollelaine
ullkammarwool-combsullkammeruldkammetogkambarvillkampawollkämmepeignes
underskällower shed faceunderskillunderskelneðra skilviriön alalangatunterfachnappe inférieure
uppknytningtie-upnedknyttingopbindinguppbindingsidontaverschnürungattachage des marches
uppknytning av harnesksolvharness tieoppknytting av harniskhovleropbinding av harnisksøller-harnesknyörien sitominenbeschnürungempoutage et colletage
uppknytningsfelharness tie faultfeil i nedknyttingenopbindingsfejl-sidontavirheverschnürungsfehlerfaute de colletage
utsparad sammetvoided velvetvelours façonné = frudsparet fløjlrósaflauelpuoliksi nukitettu samettidekorsamtvelours façonné
vadmalcoarse woollen clothvadmelvadmelvaðmálsarkalodenbure
valkningfullingvalkingvalkningþófvanutuswalkenfoulage
varpwarpvarptrenduppistaðaloimikettechaîne
varpawarping apparatusrenneapparattrendbordrakgrindluomapuutschärgerätourdissoir
varpbomwarp beamgarnbomgarnbomslöngurifurloimitukkikettbaumrouleau de chaîne
varpeffektwarp-facedrenningseffekttrendeffektþràðaráferðloimivaltaisuuskettefektarmure chaîne effet de chaîne
varpflotteringwarp floatflotterende varptrendflotteringlausaslöngur í uppistöðuloiminastakettflottierungflotté de chaîne
varpkypertwarp-faced twillrenningskyperttrendkippervaðmál með þràðaráferðloimivaltainen toimikaskettköpersergé chaîne
varpmistamissing endmanglende renningstrådmanglende trendetrådtannaglennapiitämäkettefadenfil manquant
varpmönstrad kypertwarp-faced compound twillvarpmønstret kypert = svkipper med mønster på trenden--kettköpersergé à chaînes muptiples endroit chaîne
varpmönstrad tuskaftwarp-faced compound tabbyvarpmønstret toskaft = svtoskaft med mønster på trenden--kettleinwandbindungtaffetas à chaînes multiples
varpmönstrade vävnaderwarp-faced cmpound weavesvarpmønstrete vevnader = svvævninger med mønster på trenden-loimikuviolliset kankaatkettbindungentaffetas double-face une trame façonné
varpningwarpingrenningtrendingrakningloimenluontischärenourdissage
varpripswarp ribbed fabric cannelérenningsripskæderepsþráðarbrekánloimiripsikettripscannelé
varprullarwarping spoolssnellerbobinerbalbínurloimirullatspulenbobines
varpsatinwarp-faced satinrenningssatengtrendsatinþràðarsatínloimipomsikettatlassatin chaîne
varpsidawarp faceside med renningseffekttrendsilkeborð með þràðaráferðloimivaltainen puoliketteseiteface chaîne
varpsilkeorganzineorgansintrendsilkeuppistöðusilkiloimisilkkiorganzinorgansin
varpskälportee crossskillskel i trendenþràðaskiltiuhtavarvatlesekreuzenvergeure
varpstadtransverse selvagebegynnelseskantopsætningskantupphafsjaðarloppureunawebekantelisière transversale
varpstickapaddlerennestikketrendstokrakspaðiluontilastaschärbrettplanche à trous
varptrådendrenningstrådtrendetråduppistöðuþràðurloimilankakettfadenfil de chaîne
varptuskaftwarp-faced tabbyrenningstoskafttoskaft med trendeffekthlaðorpin einskaftaloimivaltainen palttina-taffetas dominante chaîne
varptyngderloom weightskljåsteinvævevægtekljásteinarloimenpainotwebgewichtepoids de mètier
vattenrötningwater rettingvassrøytingvandrødningvatnsfeyskjunvesiliotuswasserröstenrouissage à l'eau
velours broderiebroderie velvetvelours broderie = frvelour-broderi-velours broderiestufensamtvelours broderie
velours ciseléciselé velvetvelours ciselé = frvelours ciselé-velours ciseléstufensamtvelours ciselé
vildsilkewild silkvillsilkevildsilkevillisilkivillisilkkiwildseidesoie sauvage
vådgorestykkestykkestykkileikattubahnchanteau
vådlengthlengdebanesíddpiedinbahnlaize
vänd i höjdledinverted repeatspeilvendt i høydespejlevendt på højdensahmverft á lengdinapeilattu poljentagedrehtrabouché
vävweavevevvævvefnaðurkudosgewebetissu
vävbrickortablet loombrikkervævebrikkervefspjöldlautanauhan laudatbrettchenwebgerätmétier aux cartons
vävkamcomb beatervevkamvævehammergaffallkutomavasarakammpeigne de serrage
vävlängdpiecevevvævvoðkudottu pituusstückpièce
vävnadfabricvevnadvævningvefnaðurkudonnainengewebetissu
vävningweavingvevingvævningvefnaðurkudontawebentissage
vävskedreedvevskjerørskeiðpirtarietpeigne
vävslagweavevevslagvæveartvefnaðartegundkudoslajigewebeartgenre de tissu
vävstolloomvevstolvævvefstóllkangaspuutwebstuhlmétier
vävsvärdsword beatervevskjevævesværdskeiðlyöntilastawebschwertépée
yllewoolulluldvarerullar-villawollstoffelaine
ytvarpflushing warpflushing warp = enoverkæde--flottierkettechaîne poil
ytvarpsbindningarflushing warp weavesflushing warp weaves = envævninger m. overtrend--flottierbindungen-
z-spunnetz-spunz-spunnetz-spundetz-spunniðz-kiertienenz-gesponnentors z
äfsingarthrumsefsingertrommerframhnýting of afvikurtutkaimettroddel-
ängsrötningdew rettingvollrøytingdugrødninggrafsfeyskjunnurmiliotustaurottenrouissage sur pré
ögaeyohoveløyesøløjeauganiidensilmäschaftlitzenaugeoeil
öga i harnesksolvmailhoveløyeje i harnisksølle-harneskniiden silmälitzenaugemaillon
överskälupper shed faceoverskilloverskelefra skilviriön ylälangatoberfachnappe supérieure

The data is administrated by Textilmuseet in Borås, Sweden, and fetched from Kulturnav.